PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.090630.1
Common NameCsa_2G034560, LOC101203403
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 322aa    MW: 36764.6 Da    PI: 4.8343
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.090630.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-092502842155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yp++ee+ +L+  +gL+++q+ +WF N+R ++
  Cucsa.090630.1 250 KWPYPTEEEKSKLSVTTGLDQKQINNWFINQRKRH 284
                     569*****************************885 PP

2ELK34.83.7e-12204225122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     +LK++Ll+KYsgyL+sLk+EF+
  Cucsa.090630.1 204 DLKEMLLKKYSGYLSSLKKEFL 225
                     6********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-2158102IPR005540KNOX1
PfamPF037904.3E-2160101IPR005540KNOX1
SMARTSM012561.8E-21105156IPR005541KNOX2
PfamPF037918.3E-21109155IPR005541KNOX2
PROSITE profilePS5121310.947204224IPR005539ELK domain
PfamPF037892.6E-9204225IPR005539ELK domain
SMARTSM011885.9E-6204225IPR005539ELK domain
PROSITE profilePS5007112.503224287IPR001356Homeobox domain
SuperFamilySSF466892.31E-18226296IPR009057Homeodomain-like
SMARTSM003891.5E-11226291IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-25229287IPR009057Homeodomain-like
CDDcd000862.50E-12236287No hitNo description
PfamPF059204.1E-17244283IPR008422Homeobox KN domain
PROSITE patternPS000270262285IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MEEFYRLNNP VITSYSNGVV GSEAIASTSC GEIHEALMVD DDMLQLEAEV TTGLNMSDMI  60
KTQIVNHPLY PKLVSAYIEC QKVGAPPQVA SLLEEIGREN HPSRSSIELG ADPQLDNFME  120
SYCEVLHQYK NELSKPFDEA TMFLTNIELE LSNLCKGSFT MMSDSRSAMN DEVSGTPEEE  180
PSSYEEVEMP RNHEPFCIRK TNQDLKEMLL KKYSGYLSSL KKEFLKKRKK EKLPKDARMA  240
LLDWWNTHYK WPYPTEEEKS KLSVTTGLDQ KQINNWFINQ RKRHWKPPED MRFVLMDGVG  300
AGECMKGSNF YDNGETGSHV I*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1219228LKKEFLKKRK
2225229KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818471e-131LN681847.1 Cucumis melo genomic scaffold, anchoredscaffold00003.
GenBankLN7132591e-131LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004144749.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP293e-92KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A0A0LGZ60.0A0A0A0LGZ6_CUCSA; Uncharacterized protein
STRINGVIT_14s0060g01180.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.14e-72KNOTTED-like from Arabidopsis thaliana 2
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]